Pterinotoxin-1, voltage-gated Na+ channel blocker (ab146044)

Overview

  • Product name

    Pterinotoxin-1, voltage-gated Na+ channel blocker
  • Description

    Novel blocker of voltage-gated Na+ channels NaV1.3, NaV1.7, and NaV1.8
  • Alternative names

    • Beta-theraphotoxin-Pm1a
    • Beta-TRTX-Pm1a
    • Beta-TRTX-Pm1a
    • Peptide A
  • Biological description

    Inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels. Isolated from the Pterinochilus murinus (Usambara) spider venom.

  • Purity

    > 98%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    3970.00
  • Sequence

    DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL (Modifications: C-terminal amide; Disulfide bonds: 3-18, 10-23, 17-30)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in ammonium acetate to 20 mM or in aqueous buffer above pH8
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

References

ab146044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab146044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up