Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGER3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTGER3 aa 1-51.
    Sequence:

    MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSV S


    Database link: P43115

  • Positive control

    • WB: HEK-293T overexpressing PTGER3 cell lysate. IHC-P: Human smooth muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
  • Tissue specificity

    Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EP 3 antibody
    • EP3 antibody
    • EP3 I antibody
    • EP3 II antibody
    • EP3 III antibody
    • EP3 IV antibody
    • Ep3 prostanoid receptor antibody
    • Ep3 receptor antibody
    • EP3 subtype antibody
    • EP3e antibody
    • HGNC:9595 antibody
    • MGC141828 antibody
    • MGC141829 antibody
    • MGC27302 antibody
    • PE2R3_HUMAN antibody
    • PGE receptor EP3 subtype antibody
    • PGE2 R antibody
    • PGE2 receptor EP3 subtype antibody
    • PGE2-R antibody
    • PGE2R antibody
    • Pgerep3 antibody
    • Prostaglandin E receptor 3 (subtype EP3) antibody
    • Prostaglandin E receptor 3 antibody
    • Prostaglandin E receptor EP3 subtype 3 isoform antibody
    • Prostaglandin E2 receptor antibody
    • Prostaglandin e2 receptor ep3 antibody
    • Prostaglandin E2 receptor EP3 subtype antibody
    • Prostaglandin receptor (PGE 2) antibody
    • Prostaglandin receptor 3, EP3, subtype antibody
    • Prostanoid EP3 receptor antibody
    • PTGER 3 antibody
    • Ptger3 antibody
    • Ptgerep3 antibody
    • Rep3 antibody
    • rEP3a antibody
    • rEP3b antibody
    see all

Images

  • Paraffin-embedded human smooth muscle tissue stained for PTGER3 using ab223751 at 1/50 dilution in immunohistochemical analysis.

References

ab223751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up