Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGER3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PTGER3 aa 359-408 (internal sequence). The exact sequence is proprietary. Isoform EP3E
    Sequence:

    QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV


    Database link: P43115-5

  • Positive control

    • HT1080 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab94496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
  • Tissue specificity

    Expressed in small intestine, heart, pancreas, gastric fundic mucosa, mammary artery and pulmonary vessels.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EP 3 antibody
    • EP3 antibody
    • EP3 I antibody
    • EP3 II antibody
    • EP3 III antibody
    • EP3 IV antibody
    • Ep3 prostanoid receptor antibody
    • Ep3 receptor antibody
    • EP3 subtype antibody
    • EP3e antibody
    • HGNC:9595 antibody
    • MGC141828 antibody
    • MGC141829 antibody
    • MGC27302 antibody
    • PE2R3_HUMAN antibody
    • PGE receptor EP3 subtype antibody
    • PGE2 R antibody
    • PGE2 receptor EP3 subtype antibody
    • PGE2-R antibody
    • PGE2R antibody
    • Pgerep3 antibody
    • Prostaglandin E receptor 3 (subtype EP3) antibody
    • Prostaglandin E receptor 3 antibody
    • Prostaglandin E receptor EP3 subtype 3 isoform antibody
    • Prostaglandin E2 receptor antibody
    • Prostaglandin e2 receptor ep3 antibody
    • Prostaglandin E2 receptor EP3 subtype antibody
    • Prostaglandin receptor (PGE 2) antibody
    • Prostaglandin receptor 3, EP3, subtype antibody
    • Prostanoid EP3 receptor antibody
    • PTGER 3 antibody
    • Ptger3 antibody
    • Ptgerep3 antibody
    • Rep3 antibody
    • rEP3a antibody
    • rEP3b antibody
    see all

Images

  • Anti-PTGER3 antibody (ab94496) at 1 µg/ml + HT1080 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 43 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Ye Y  et al. Prostaglandin E2 receptor 3 signaling is induced in placentas with unexplained recurrent pregnancy losses. Endocr Connect 7:749-761 (2018). Read more (PubMed: 29700097) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for contacting us yesterday and I am sorry for the delay in getting back to you.

As discussed over the phone, I have had a look into how much peptide we would suggest using in the blocking experiment you are planning. As I mentioned over the phone, we have as yet not used the antibody ab94496 in IHC and I therefore cannot recommend from a protocol we have used. What I can say is that we would typically work from a 200 fold molar excess of peptide when using it for Western blotting blocking. For this peptide, this would mean using 32 µg/mL for your experiment (assuming you are using a 1/250 dilution, 4 µg/mL). As you mentioned over the phone, this is quite a large proportion of the whole ab151180 product. I would say that a 50 molar excess should be enough for the blocking, so using 8 µg/mL. However, as I have mentioned, we have not tried it ourselves and would therefore not be able to guarantee it.

I'd like to provide you with an offer in order to make it a little less prohibitive in order to purchase another lot of blocking peptide. If you would agree to share the results you have obtained with ab94496 and ab151180 in IHC through submitting an Abreview, I can offer to provide you with another vial of ab151180 for free (or for you to use the same value off any product in our catalogue, £113). An Abreview should not take very much time to complete, at most 5-10 minutes. An example of one can be viewed from the following link:

https://www.abcam.com/index.html?datasheet=1316&tab=abreviews&intabreviewid=8763

Let me know if you would be interested in this offer.

I am still looking into why you had to wait for almost a month for ab151180 to be shipped, and if this is likely to be the case if it is ordered again. I will get back to you as soon as I have further information to share with you.

Read More
Application
Western blot
Sample
Human Tissue lysate - whole (Abdominal endometriotic lesion)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
15 µg
Specification
Abdominal endometriotic lesion
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Mar 21 2017

Answer

I now have further information to share with you in regards to the anti-PTGER3 antibody (ab94496).

I can confirm that the delay in your previous order for the peptide was due to the peptide not being available in stock. It therefore had to be produced in order to fulfill your order. I am sorry for this delay and any inconvenience it has caused you. This would not be the case if you were to place an order in the near future as there is now units available directly in stock. We would estimate a delivery time of 2 weeks or less.

I hope this information has been of help. If I can be of any further assistance, please do not hesitate to ask.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up