Anti-PTGES2/Gbf1 antibody (ab229961)
Key features and details
- Rabbit polyclonal to PTGES2/Gbf1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PTGES2/Gbf1 antibody
See all PTGES2/Gbf1 primary antibodies -
Description
Rabbit polyclonal to PTGES2/Gbf1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Cynomolgus monkey
-
Immunogen
Recombinant fragment corresponding to Human PTGES2/Gbf1 aa 88-377.
Sequence:ERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRR AEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIIT YYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQW ADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMY LISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAV YGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAITEASPAH
Database link: Q9H7Z7 -
Positive control
- WB: HEK-293T, HeLa and HepG2 whole cell lysate (ab7900). IHC-P: Human colon cancer and placenta tissues.
-
General notes
This product was previously labelled as PTGES2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab229961 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. Detects a band of approximately 42 kDa (predicted molecular weight: 42 kDa). |
Target
-
Function
Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear. -
Tissue specificity
Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, frontal and parietal lobes. Also expressed in the lymph nodes, skeletal muscle, kidney and trachea, but not in the thymus or lung. Overexpressed in colorectal cancer. -
Pathway
Lipid metabolism; prostaglandin biosynthesis. -
Sequence similarities
Belongs to the GST superfamily.
Contains 1 glutaredoxin domain.
Contains 1 GST C-terminal domain. -
Cellular localization
Golgi apparatus membrane and Cytoplasm > perinuclear region. Synthetized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region. - Information by UniProt
-
Database links
- Entrez Gene: 493639 Cow
- Entrez Gene: 102140040 Cynomolgus monkey
- Entrez Gene: 80142 Human
- Omim: 608152 Human
- SwissProt: Q66LN0 Cow
- SwissProt: Q9N0A4 Cynomolgus monkey
- SwissProt: Q9H7Z7 Human
- Unigene: 495219 Human
-
Alternative names
- C9orf15 antibody
- FLJ14038 antibody
- Gamma interferon activated transcriptional element binding factor 1 antibody
see all
Images
-
Western blot - Anti-PTGES2/Gbf1 antibody (ab229961)All lanes : Anti-PTGES2/Gbf1 antibody (ab229961) at 1/1000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 42 kDa
Observed band size: 42 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PTGES2/Gbf1 antibody (ab229961)Paraffin-embedded human colon cancer tissue stained for PTGES2/Gbf1 using ab229961 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PTGES2/Gbf1 antibody (ab229961)Paraffin-embedded human placenta tissue stained for PTGES2/Gbf1 using ab229961 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab229961 has not yet been referenced specifically in any publications.
