Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGES2/Gbf1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PTGES2/Gbf1 aa 145-357. (Expressed in E.coli).
    Sequence:

    YRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKA VNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVH LISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLK SRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVM EGLDAFDDLMQHT


    Database link: Q9H7Z7

  • Positive control

    • IHC-P: Human brain, liver, colorectal cancer and kidney tissues. WB: HepG2 and HeLa cell lysates; Pig and mouse heart lysates; Recombinant human PTGES2/Gbf1 protein.
  • General notes

     This product was previously labelled as PTGES2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233274 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
  • Tissue specificity

    Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, frontal and parietal lobes. Also expressed in the lymph nodes, skeletal muscle, kidney and trachea, but not in the thymus or lung. Overexpressed in colorectal cancer.
  • Pathway

    Lipid metabolism; prostaglandin biosynthesis.
  • Sequence similarities

    Belongs to the GST superfamily.
    Contains 1 glutaredoxin domain.
    Contains 1 GST C-terminal domain.
  • Cellular localization

    Golgi apparatus membrane and Cytoplasm > perinuclear region. Synthetized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • C9orf15 antibody
    • FLJ14038 antibody
    • Gamma interferon activated transcriptional element binding factor 1 antibody
    • GATE binding factor 1 antibody
    • GBF 1 antibody
    • GBF1 antibody
    • Membrane associated prostaglandin E synthase 2 antibody
    • MGC11289 antibody
    • Microsomal prostaglandin E synthase 2 antibody
    • mPGES 2 antibody
    • mPGES-2 antibody
    • PGES2 antibody
    • PGES2_HUMAN antibody
    • Prostaglandin E synthase 2 antibody
    • Prostaglandin E synthase 2 truncated form antibody
    • PTGES 2 antibody
    • PTGES2 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for PTGES2/Gbf1 using ab233274 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for PTGES2/Gbf1 using ab233274 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for PTGES2/Gbf1 using ab233274 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PTGES2/Gbf1 antibody (ab233274) at 2 µg/ml + Recombinant human PTGES2/Gbf1 protein

    Predicted band size: 42 kDa

  • Anti-PTGES2/Gbf1 antibody (ab233274) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 42 kDa

  • Anti-PTGES2/Gbf1 antibody (ab233274) at 2 µg/ml + Pig heart lysate

    Predicted band size: 42 kDa

  • Anti-PTGES2/Gbf1 antibody (ab233274) at 2 µg/ml + Mouse heart lysate

    Predicted band size: 42 kDa

  • Anti-PTGES2/Gbf1 antibody (ab233274) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 42 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PTGES2/Gbf1 using ab233274 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up