Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGFRN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTGFRN aa 367-471.
    Sequence:

    NSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASK VPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAV MDGDW


    Database link: Q9P2B2

  • Positive control

    • IHC: Human uterine cervix tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inhibits the binding of prostaglandin F2-alpha (PGF2-alpha) to its specific FP receptor, by decreasing the receptor number rather than the affinity constant. Functional coupling with the prostaglandin F2-alpha receptor seems to occur.
  • Sequence similarities

    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus > trans-Golgi network membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD315 antibody
    • CD9 partner 1 antibody
    • CD9P-1 antibody
    • CD9P1 antibody
    • EWI F antibody
    • EWI-F antibody
    • FLJ11001 antibody
    • FPRP antibody
    • FPRP_HUMAN antibody
    • Glu Trp Ile EWI motif containing protein F antibody
    • Glu-Trp-Ile EWI motif-containing protein F antibody
    • KIAA1436 antibody
    • Prostaglandin F2 alpha receptor associated protein antibody
    • Prostaglandin F2 alpha receptor regulatory protein antibody
    • Prostaglandin F2 receptor inhibitor antibody
    • Prostaglandin F2 receptor negative regulator antibody
    • Prostaglandin F2-alpha receptor regulatory protein antibody
    • Prostaglandin F2-alpha receptor-associated protein antibody
    • Ptgfrn antibody
    • SMAP 6 antibody
    see all

Images

  • Paraffin-embedded human uterine cervix tissue stained for PTGFRN using ab224392 at 1/20 dilution in immunohistochemical analysis.

References

ab224392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up