Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTGR1 aa 202-282.
    Sequence:

    TLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPL PPGPPPEIVIYQELRMEAFVVYRWQGDARQK


    Database link: Q14914

  • Positive control

    • IHC-P: Human liver tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.
  • Tissue specificity

    High expression in the kidney, liver, and intestine but not in leukocytes.
  • Sequence similarities

    Belongs to the NADP-dependent oxidoreductase L4BD family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 15-oxoprostaglandin 13-reductase antibody
    • FLJ99229 antibody
    • leukotriene B4 12-hydroxydehydrogenase antibody
    • LTB4DH antibody
    • MGC34943 antibody
    • NADP-dependent leukotriene B4 12-hydroxydehydrogenase antibody
    • PGR1 antibody
    • PRG-1 antibody
    • Prostaglandin reductase 1 antibody
    • Ptgr1 antibody
    • PTGR1_HUMAN antibody
    • RP11-16L21.1 antibody
    • ZADH3 antibody
    • zinc binding alcohol dehydrogenase domain containing 3 antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for PTGR1 using ab222818 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PTGR1 (green) using ab222818 at 1/100 dilution in ICC/IF.

References

ab222818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up