Overview

  • Product name

  • Description

    Rabbit polyclonal to PTGR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PTGR2 aa 206-282.
    Sequence:

    INYKKDNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQ ISQYNKDVPYPPPLSPAIEAIQKERNI


    Database link: Q8N8N7

  • Positive control

    • WB: HEK-293, HepG2 and HeLa whole cell lysates. IHC-P: Human testis and kidney tissues. ICC/IF: A549 cells.
  • General notes

     This product was previously labelled as ZADH1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.

Target

  • Function

    Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-keto-PGE1, 15-keto-PGE2, 15-keto-PGE1-alpha and 15-keto-PGE2-alpha with highest activity towards 15-keto-PGE2. Overexpression represses transcriptional activity of PPARG and inhibits adipocyte differentiation.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the NADP-dependent oxidoreductase L4BD family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 15 oxoprostaglandin 13 reductase antibody
    • 15 oxoprostaglandin delta 13 reductase antibody
    • 15-oxoprostaglandin 13-reductase antibody
    • DKFZp686P10120 antibody
    • FLJ39091 antibody
    • FLJ99229 antibody
    • PGR 2 antibody
    • PGR2 antibody
    • PRG-2 antibody
    • Prostaglandin reductase 2 antibody
    • PTGR 2 antibody
    • PTGR2 antibody
    • PTGR2_HUMAN antibody
    • Zinc binding alcohol dehydrogenase domain containing 1 antibody
    • Zinc binding alcohol dehydrogenase domain containing protein 1 antibody
    • Zinc-binding alcohol dehydrogenase domain-containing protein 1 antibody
    see all

Images

  • All lanes : Anti-PTGR2 antibody (ab236891) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

  • Paraffin-embedded human testis tissue stained for PTGR2 using ab236891 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for PTGR2 using ab236891 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixe, 0.2% Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells labeling PTGR2 using ab236891 at 1/166 dilution in ICC/IF.

    Cells were blocked in 10% normal goat serum and incubated with primary antibody overnight at 4°C. Secondary antibody used was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab236891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up