Overview

  • Product name

  • Description

    Rabbit polyclonal to PTH2R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Rat PTH2R aa 27-143. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    DSDGTITIEEQIVLVMKAKMQCELNITAQFQEGEGNCFPEWDGLICWPRG TAGKTSAMPCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCF LQPDINIGKQEFFENLY


    Database link: P70555

  • Positive control

    • IHC-P: Rat brain and kidney tissues. WB: Rat pancreas lysate; Recombinant rat PTH2R protein.
  • General notes

     This product was previously labelled as Parathyroid Hormone Receptor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 62 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor.
  • Tissue specificity

    Expressed abundantly in brain and pancreas. Also expressed in the testis.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Parathyroid hormone 2 receptor antibody
    • Parathyroid hormone receptor precursor antibody
    • PTH 2 receptor antibody
    • PTH2 receptor antibody
    • Pth2r antibody
    • PTH2R_HUMAN antibody
    • Pthr 2 antibody
    • Pthr2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for PTH2R using ab231556 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for PTH2R using ab231556 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PTH2R antibody (ab231556) at 2 µg/ml + Recombinant rat PTH2R protein

    Predicted band size: 62 kDa

  • Anti-PTH2R antibody (ab231556) at 1 µg/ml + Rat pancreas lysate

    Predicted band size: 62 kDa

References

ab231556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up