Overview

  • Product name

  • Description

    Rabbit polyclonal to PTHLH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human PTHLH aa 35-157.
    Sequence:

    KRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKP SPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRK EQEKKKRRTRSAWLDSGVTGSGL


    Database link: P12272

  • Positive control

    • IHC-P: Human breast tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.
    Osteostatin is a potent inhibitor of osteoclastic bone resorption.
  • Tissue specificity

    Ubiquitous. Also expressed in the mammary gland.
  • Involvement in disease

    Brachydactyly E2
  • Sequence similarities

    Belongs to the parathyroid hormone family.
  • Post-translational
    modifications

    There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions.
  • Cellular localization

    Cytoplasm. Nucleus. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • HHM antibody
    • MGC14611 antibody
    • Osteostatin antibody
    • Parathyroid hormon like hormone isoform 2 preproprotein antibody
    • Parathyroid hormone like hormone antibody
    • Parathyroid hormone like hormone isoform 1 preproprotein antibody
    • Parathyroid hormone like protein antibody
    • Parathyroid hormone like related protein antibody
    • Parathyroid hormone related protein antibody
    • Parathyroid hormone-like protein antibody
    • Parathyroid like protein antibody
    • PLP antibody
    • PTH related protein antibody
    • PTH-rP antibody
    • PTHLH antibody
    • PTHR antibody
    • PTHR_HUMAN antibody
    • PTHrP antibody
    • PTHrP[107-139] antibody
    see all

Images

  • Paraffin-embedded human breast tissue stained for PTHLH using ab224503 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for PTHLH (green) using ab224503 at 4 µg/ml in ICC/IF.

References

ab224503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
IHC - Wholemount
Sample
Dog Tissue (Skin)
Specification
Skin

Amy N Schnelle

Verified customer

Submitted Oct 25 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up