Overview

  • Product name

    Anti-PTHLH antibody [D1]
    See all PTHLH primary antibodies
  • Description

    Mouse monoclonal [D1] to PTHLH
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Rat PTHLH aa 37-177. Two N-terminal tags, His-tag and S-tag (Expressed in E.coli).
    Sequence:

    AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAP NTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQ EKKKRRTRSAWPGTTGSGLLEDPQPHTSPTSTSLEPSSRTH


    Database link: P13085

  • Positive control

    • IHC-P: Rat pancreas tissue. WB: Rat thymus lysate; Recombinant rat PTHLH protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab239527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 20 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.
    Osteostatin is a potent inhibitor of osteoclastic bone resorption.
  • Tissue specificity

    Ubiquitous. Also expressed in the mammary gland.
  • Involvement in disease

    Brachydactyly E2
  • Sequence similarities

    Belongs to the parathyroid hormone family.
  • Post-translational
    modifications

    There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions.
  • Cellular localization

    Cytoplasm. Nucleus. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • HHM antibody
    • MGC14611 antibody
    • Osteostatin antibody
    • Parathyroid hormon like hormone isoform 2 preproprotein antibody
    • Parathyroid hormone like hormone antibody
    • Parathyroid hormone like hormone isoform 1 preproprotein antibody
    • Parathyroid hormone like protein antibody
    • Parathyroid hormone like related protein antibody
    • Parathyroid hormone related protein antibody
    • Parathyroid hormone-like protein antibody
    • Parathyroid like protein antibody
    • PLP antibody
    • PTH related protein antibody
    • PTH-rP antibody
    • PTHLH antibody
    • PTHR antibody
    • PTHR_HUMAN antibody
    • PTHrP antibody
    • PTHrP[107-139] antibody
    see all

Images

  • Paraffin-embedded rat pancreas tissue stained for PTHLH using ab239527 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PTHLH antibody [D1] (ab239527) at 6 µg/ml + Rat thymus lysate

    Predicted band size: 20 kDa

  • Anti-PTHLH antibody [D1] (ab239527) at 2 µg/ml + Recombinant rat PTHLH protein

    Predicted band size: 20 kDa

References

ab239527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up