Overview

  • Product name

  • Description

    Rabbit polyclonal to PTP-H1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PTP-H1 aa 1-913.
    Sequence:

    MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDT GQVLLDMVHNHLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFP CTLHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLA SYAVQSHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHSGLKQ SEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICT SFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVW NPAMRRSLSVEHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLA NEMTYITETEDVFYTYKGSLAPQDSDSEVSQNRSPHQESLSENNPAQSYL TQKSSSSVSPSSNAPGSCSPDGVDQQLLDDFHRVTKGGSTEDASQYYCDK NDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCI PKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQF EQLYRKKPGLAITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASY VNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERG RTKCHQYWPDPPDVMNHGGFHIQCQSEDCTIAYVSREMLVTNTQTGEEHT VTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLVHCSAGIGRTG VLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR VYEEGLVQMLDPS


    Database link: P26045

  • Positive control

    • A549, BT474, 293T, mouse brain and rat brain cell lysates.
  • General notes

    Protein previously labeled as PTPN3.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 103 kDa.

Target

  • Function

    May act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
    Contains 1 FERM domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cell membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • cytoskeletal-associated protein tyrosine phosphatase antibody
    • protein tyrosine phosphatase H1 antibody
    • protein tyrosine phosphatase non-receptor type 3 antibody
    • Protein-tyrosine phosphatase H1 antibody
    • PTN3_HUMAN antibody
    • PTP-H1 antibody
    • PTPH1 antibody
    • PTPN3 antibody
    • Tyrosine-protein phosphatase non-receptor type 3 antibody
    see all

Images

  • All lanes : Anti-PTP-H1 antibody (ab202124) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : BT474 cell lysate
    Lane 3 : 293T cell lysate
    Lane 4 : Mouse brain cell lysate
    Lane 5 : Rat brain cell lysate

    Predicted band size: 103 kDa

References

ab202124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up