Overview

  • Product name
    Anti-PTP1B antibody [4F8F11]
    See all PTP1B primary antibodies
  • Description
    Mouse monoclonal [4F8F11] to PTP1B
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IF, Flow Cyt, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human PTP1B aa 40-246. (Purified from E.coli).
    Sequence:

    NKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLP NTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTN LKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPA SFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRK DPSSVDI


    Database link: P18031

  • Positive control
    • Human PTP1B (aa40-246) recombinant protein; PTP1B (aa40-246)-hIgGFc transfected HEK293 cell lysate; Jurkat and MCF7 cell lysates; HeLa and Jurkat cells; Human bladder cancer tissue.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR256355-19 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab201974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 50 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.

Target

  • Function
    May play an important role in CKII- and p60c-src-induced signal transduction cascades.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications
    Oxidized on Cys-215; the Cys-SOH formed in response to redox signaling reacts with the alpha-amido of the following residue to form a 4-amino-3-isothiazolidinone serine cross-link, triggering a conformational change that inhibits substrate binding and activity. The active site can be restored by reduction.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • PTP1B antibody
    • Non receptor tyrosine phosphatase 1 antibody
    • Protein phosphotyrosylphosphatase 1B antibody
    • Protein tyrosine phosphatase 1B antibody
    • Protein tyrosine phosphatase non receptor type 1 antibody
    • Protein tyrosine phosphatase placental antibody
    • Protein-tyrosine phosphatase 1B antibody
    • PTN1_HUMAN antibody
    • PTP 1B antibody
    • PTP-1B antibody
    • PTPN 1 antibody
    • PTPN1 antibody
    • Tyrosine protein phosphatase non receptor type 1 antibody
    • Tyrosine-protein phosphatase non-receptor type 1 antibody
    see all

Images

  • Lane 1: Wild-type HAP1 cell lysate (20 µg)
    Lane 2: PTP1B knockout HAP1 cell lysate (20 µg)
    Lane 3: Jurkat cell lysate (20 µg)
    Lane 4: MCF7 cell lysate (20 µg)
    Lanes 1 - 4: Merged signal (red and green). Green - ab201974 observed at 54 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab201974 was shown to specifically react with PTP1B when PTP1B knockout samples were used. Wild-type and PTP1B knockout samples were subjected to SDS-PAGE. ab201974 and ab181602 (loading control to GAPDH) were diluted 1/500 and 1/2000 respectively and incubated overnight at 4°C. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) and Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) secondary antibodies at 1/10 000 dilution for 1 h at room temperature before imaging.

  • Anti-PTP1B antibody [4F8F11] (ab201974) at 1/500 dilution + Human PTP1B (aa40-246) recombinant protein

    Predicted band size: 50 kDa



    Expected MWt is 50 kDa.

  • All lanes : Anti-PTP1B antibody [4F8F11] (ab201974) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : PTP1B (aa40-246)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 50 kDa

  • All lanes : Anti-PTP1B antibody [4F8F11] (ab201974) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : MCF7 cell lysate

    Predicted band size: 50 kDa

  • Immunofluorescent analysis of HeLa cells labeling PTP1B with ab201974 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. 

  • Flow cytometric analysis of Jurkat cells labeling PTP1B with ab201974 at 1/200 dilution (green) compared to a negative control (red).

  • Immunohistochemical analysis of paraffin-embedded Human bladder cancer tissue labeling PTP1B with ab201974 at 1/200 dilution folowed by DAB staining.

References

This product has been referenced in:
  • Balland E  et al. Leptin Signaling in the Arcuate Nucleus Reduces Insulin's Capacity to Suppress Hepatic Glucose Production in Obese Mice. Cell Rep 26:346-355.e3 (2019). Read more (PubMed: 30625317) »
  • Tsutsumi R  et al. Assay to visualize specific protein oxidation reveals spatio-temporal regulation of SHP2. Nat Commun 8:466 (2017). Read more (PubMed: 28878211) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up