Overview

  • Product name

    Anti-PTPH1 antibody - N-terminal
  • Description

    Rabbit polyclonal to PTPH1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human PTPH1 aa 1-47 (N terminal) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTK


    Database link: P26045

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

WB 1/100 - 1/1000. Predicted molecular weight: 104 kDa.

Target

  • Function

    May act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
    Contains 1 FERM domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cell membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytoskeletal associated protein tyrosine phosphatase antibody
    • Protein tyrosine phosphatase H1 antibody
    • Protein tyrosine phosphatase non receptor type 3 antibody
    • Protein-tyrosine phosphatase H1 antibody
    • PTN3_HUMAN antibody
    • PTP H1 antibody
    • PTP-H1 antibody
    • PTPN3 antibody
    • Tyrosine-protein phosphatase non-receptor type 3 antibody
    see all

References

ab203617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up