Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPIP51
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PTPIP51 aa 198-330.
    Sequence:

    DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADE LHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEK KSYALDGKEEAEAALEKGDESADCHLWYAVLCG


    Database link: Q96TC7

  • Positive control

    • WB: Caco-2 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human testis and skin tissue.
  • General notes

     This product was previously labelled as FAM82A2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/250 - 1/500. Predicted molecular weight: 52 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    FAM82A2, or family with sequence similarity 82, member C, may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82A2 induces apoptosis.
  • Cellular localization

    Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Nucleus. Note=In interphase localizes in the cytoplasm, and during mitosis localizes to the spindle microtubules and spindle poles.
  • Database links

  • Alternative names

    • Cerebral protein 10 antibody
    • FAM82C antibody
    • FAM82C, formerly antibody
    • Family with sequence similarity 82 member C antibody
    • Family with sequence similarity 82 member C, formerly antibody
    • Family with sequence similarity 82, member A2 antibody
    • FLJ10579 antibody
    • hRMD 3 antibody
    • Microtubule associated protein antibody
    • Protein FAM82A2 antibody
    • Protein FAM82C antibody
    • Protein tyrosine phosphatase interacting protein 51 antibody
    • PTPIP51 antibody
    • Regulator of microtubule dynamics 3 antibody
    • Regulator of microtubule dynamics protein 3 antibody
    • RMD 3 antibody
    • RMD3 antibody
    • TCPTP interacting protein 51 antibody
    see all

Images

  • Anti-PTPIP51 antibody (ab224081) at 1/250 dilution + Caco-2 (human colorectal adenocarcinoma cell line) cell lysate

    Predicted band size: 52 kDa

  • Paraffin-embedded human testis tissue staining PTPIP51 with ab224081 at 1/500 dilution in immunohistochemical analysis. Strong cytoplasmic positibity in seminiferous duct cells.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PTPIP51 (green) using ab224081 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human skeletal muscle tissue staining PTPIP51 with ab224081 at 1/500 dilution in immunohistochemical analysis. Weak cytoplasmic positivity in myocytes.

  • Paraffin-embedded human skin tissue staining PTPIP51 with ab224081 at 1/500 dilution in immunohistochemical analysis. Moderate to strong cytoplasmic positibity in keratinocytes.

  • Paraffin embedded human testis tissue stained for PTPIP51 with ab224081 (1/1000 dilution) in immunohistochemical analysis.

References

ab224081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up