Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPN14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTPN14 aa 725-795.
    Sequence:

    PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPA MARARVLRHGPAKAISMSRTD


    Database link: Q15678

  • Positive control

    • Human colon tissue. HeLa cells. U-251 MG cell lysate.
  • General notes

     This product was previously labelled as PTPD2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 135 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Protein tyrosine phosphatase which may play a role in the regulation of lymphangiogenesis.
  • Tissue specificity

    Expressed in a variety of human tissues including kidney, skeletal muscle, lung and placenta.
  • Involvement in disease

    Defects in PTPN14 are a cause of choanal atresia and lymphedema (CHATLY) [MIM:613611]. A disease characterized by posterior choanal atresia and lymphedema. Additional features are a high-arched palate, hypoplastic nipples, and mild pectus excavatum. Note=A homozygous deletion in PTPN14 predicted to result in frameshift and premature truncation, has been shown to be the cause of choanal atresia and lymphedema in one family.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
    Contains 1 FERM domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytoskeletal associated protein tyrosine phosphatase antibody
    • MGC126803 antibody
    • PEZ antibody
    • Phosphatase with ezrin domain antibody
    • Protein tyrosine phosphatase non receptor type 14 antibody
    • Protein tyrosine phosphatase pez antibody
    • Protein-tyrosine phosphatase pez antibody
    • PTN14_HUMAN antibody
    • PTP 36 antibody
    • PTP36 antibody
    • PTPD 2 antibody
    • PTPN 14 antibody
    • PTPN14 antibody
    • Tyrosine protein phosphatase non receptor type 14 antibody
    • Tyrosine-protein phosphatase non-receptor type 14 antibody
    see all

Images

  • All lanes : Anti-PTPN14 antibody (ab204321) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Developed using the ECL technique.

    Predicted band size: 135 kDa

  • Immunofluorescent analysis of HeLa cells (PFA-fixed/Triton X-100 permeabilized) labeling PTPN14 with ab204321 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue, labeling PTPN14 with ab204321 at 1/50 dilution.

References

ab204321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up