Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPN22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTPN22 aa 594-714.
    Sequence:

    SLLNQESAVLATAPRIDDEIPPPLPVRTPESFIVVEEAGEFSPNVPKSLS SAVKVKIGTSLEWGGTSEPKKFDDSVILRPSKSVKLRSPKSELHQDRSSP PPPLPERTLESFFLADEDCMQ


    Database link: None

  • Positive control

    • IHC-P: Human bone marrow tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Seems to act on Cbl. May play a role in regulating the function of Cbl and its associated protein kinases. Acts as negative regulator of T cell receptor (TCR) signaling. Dephosphorylates and inactivates the SRC family kinases.
  • Tissue specificity

    Predominantly expressed in lymphoid tissues and cells. Isoform 1 is expressed in thymocytes and both mature B and T-cells.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Post-translational
    modifications

    Phosphorylation on Ser-35 by PKC/PRKCD abrogates its ability to dephosphorylate and inactivate the SRC family kinases.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hematopoietic cell protein tyrosine phosphatase 70Z PEP antibody
    • Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP antibody
    • Lymphoid phosphatase antibody
    • Lymphoid specific protein tyrosine phosphatase antibody
    • lymphoid-specific, inducible human protein tyrosine phosphatase antibody
    • Lyp 1 antibody
    • Lyp 2 antibody
    • LyP antibody
    • Lyp1 antibody
    • Lyp2 antibody
    • LyPTP antibody
    • OTTHUMP00000013720 antibody
    • OTTHUMP00000013721 antibody
    • OTTHUMP00000233450 antibody
    • OTTHUMP00000233451 antibody
    • PEP antibody
    • PEST-domain phosphatase antibody
    • Protein tyrosine phosphatase non receptor type 22 (lymphoid) antibody
    • Protein tyrosine phosphatase non receptor type 22 antibody
    • Protein tyrosine phosphatase non receptor type 8 antibody
    • Protein tyrosine phosphatase non receptor type 8, formerly antibody
    • PTN22_HUMAN antibody
    • PTPN 22 antibody
    • PTPN 8 antibody
    • Ptpn22 antibody
    • PTPN8 antibody
    • PTPN8, formerly antibody
    • Tyrosine-protein phosphatase non-receptor type 22 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human bone marrow tissue stained for PTPN22 with ab244330 at a 1/20 dilution in immunohistochemical analysis.

References

ab244330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up