Overview

  • Product name

    Anti-PTPN9 antibody
  • Description

    Rabbit polyclonal to PTPN9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTPN9.
    Sequence:

    LATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELV DYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNL

  • Positive control

    • Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store undiluted.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Protein-tyrosine phosphatase that could participate in the transfer of hydrophobic ligands or in functions of the Golgi apparatus.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 3 subfamily.
    Contains 1 CRAL-TRIO domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • MEG2 antibody
    • non-receptor type 9 antibody
    • protein tyrosine phosphatase antibody
    • Protein tyrosine phosphatase MEG2 antibody
    • Protein-tyrosine phosphatase MEG2 antibody
    • PTN9_HUMAN antibody
    • PTPase MEG2 antibody
    • Ptpn9 antibody
    • Tyrosine protein phosphatase non receptor type 9 antibody
    • Tyrosine-protein phosphatase non-receptor type 9 antibody
    see all

Images

  • Immunofluorescent staining of Human cell line U-251 MG shows positivity in cytoplasm and golgi apparatus. Recommended concentration of ab122756 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122756 at 1/200 dilution, staining PTPN9 in Paraffin-embedded Human stomach tissue by Immunohistochemistry.

References

ab122756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up