Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPRK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PTPRK aa 30-98.
    Sequence:

    QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMI VDSSDHDPGEKARLQLPTM


    Database link: Q15262

  • Positive control

    • ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as PTP kappa

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Regulation of processes involving cell contact and adhesion such as growth control, tumor invasion, and metastasis. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTP-kappa.
  • Tissue specificity

    High levels in lung, brain and colon; less in liver, pancreas, stomach, kidney, placenta and mammary carcinoma.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 2B subfamily.
    Contains 4 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 MAM domain.
    Contains 2 tyrosine-protein phosphatase domains.
  • Post-translational
    modifications

    This protein undergoes proteolytic processing.
  • Cellular localization

    Cell junction > adherens junction. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ480J14.2.1 antibody
    • DKFZp686C2268 antibody
    • DKFZp779N1045 antibody
    • OTTHUMP00000017180 antibody
    • OTTHUMP00000017181 antibody
    • OTTHUMP00000017182 antibody
    • OTTHUMP00000017187 antibody
    • OTTHUMP00000040306 antibody
    • Protein tyrosine phosphatase kappa antibody
    • Protein tyrosine phosphatase kappa precursor antibody
    • Protein tyrosine phosphatase receptor type K antibody
    • Protein tyrosine phosphatase receptor type kappa antibody
    • Protein-tyrosine phosphatase kappa antibody
    • PTPK antibody
    • PTPkappa antibody
    • Ptprk antibody
    • PTPRK_HUMAN antibody
    • R PTP kappa antibody
    • R-PTP-kappa antibody
    • Receptor type tyrosine protein phosphatase kappa antibody
    • Receptor-type tyrosine-protein phosphatase kappa antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for PTPRK (green) using ab222249 at 4 µg/ml in ICC/IF.

References

ab222249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up