Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPRM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PTPRM aa 1197-1403. (Expressed in E.coli).
    Sequence:

    TPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAA LMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCP QYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQF QFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRS GTFCAIS


    Database link: P28827

  • Positive control

    • IHC-P: Human kidney tissue. WB: Human liver and serum and mouse cerebrum tissue lysates and recombinant human PTPRM protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231607 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 164 kDa.

Target

  • Function

    Involved in cell-cell adhesion through homophilic interactions. May play a key role in signal transduction and growth control.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 2B subfamily.
    Contains 4 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 MAM domain.
    Contains 2 tyrosine-protein phosphatase domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • PTPRL 1 antibody
    • hR PTPu antibody
    • Protein tyrosine phosphatase mu antibody
    • Protein tyrosine phosphatase mu precursor antibody
    • Protein tyrosine phosphatase receptor type M antibody
    • Protein tyrosine phosphatase receptor type mu polypeptide antibody
    • Protein-tyrosine phosphatase mu antibody
    • PTPRL1 antibody
    • Ptprm antibody
    • PTPRM protein antibody
    • PTPRM_HUMAN antibody
    • R PTP mu antibody
    • R-PTP-mu antibody
    • Receptor type tyrosine protein phosphatase mu antibody
    • Receptor-type tyrosine-protein phosphatase mu antibody
    • RPTP mu antibody
    • RPTPM antibody
    • RPTPU antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PTPRM using ab231607 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PTPRM antibody (ab231607) at 2 µg/ml + Recombinant human PTPRM protein

    Predicted band size: 164 kDa

  • Anti-PTPRM antibody (ab231607) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 164 kDa

  • Anti-PTPRM antibody (ab231607) at 2 µg/ml + Human liver lysate

    Predicted band size: 164 kDa

  • Anti-PTPRM antibody (ab231607) at 2 µg/ml + Human serum

    Predicted band size: 164 kDa

References

ab231607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up