Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPRN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTPRN2 aa 382-492.
    Sequence:

    QDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARPLDMERKKSEHP ESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGPS KEEQSLPAGAQ


    Database link: Q92932

  • Positive control

    • IHC-P: Human liver tissue. WB: U-87 MG cell lysate. ICC/IF: AF22 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 111 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Implicated in development of nervous system and pancreatic endocrine cells.
  • Tissue specificity

    Highest levels in brain and pancreas. Lower levels in trachea, prostate, stomach and spinal chord.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 8 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Domain

    The cytoplasmic domain appears to contain the autoantigenic epitopes.
  • Post-translational
    modifications

    Appears to undergo multiple proteolytic cleavage at consecutive basic residues.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • IA 2beta antibody
    • IA2beta antibody
    • IAR antibody
    • IAR/receptor like protein tyrosine phosphatase antibody
    • ICAAR antibody
    • Islet cell autoantigen related protein antibody
    • Islet cell autoantigen-related protein antibody
    • Phogrin antibody
    • Protein tyrosine phosphatase receptor pi antibody
    • Protein tyrosine phosphatase, receptor type, N polypeptide 2 antibody
    • PTPR2_HUMAN antibody
    • Ptprn2 antibody
    • PTPRP antibody
    • R PTP N2 antibody
    • R-PTP-N2 antibody
    • Receptor-type tyrosine-protein phosphatase N2 antibody
    • Tyrosine phosphatase IA 2 beta antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized AF22 cells labeling PTPRN2 using ab244293 at 4 µg/ml (green) in ICC/IF.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PTPRN2 with ab244293 at a 1/50 dilution in immunohistochemical analysis.

  • Anti-PTPRN2 antibody (ab244293) at 0.4 µg/ml + U-87 MG (Human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 111 kDa

References

ab244293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up