Overview

  • Product name

  • Description

    Rabbit polyclonal to PTPRS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PTPRS aa 25-128.
    Sequence:

    GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVN SQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTV LRED


    Database link: Q13332

  • Positive control

    • IHC-P: Human brain and ovarian cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Interacts with LAR-interacting protein LIP.1.
  • Tissue specificity

    Detected in all tissues tested except for placenta and liver.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Receptor class 2A subfamily.
    Contains 8 fibronectin type-III domains.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 2 tyrosine-protein phosphatase domains.
  • Post-translational
    modifications

    A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein tyrosine phosphatase PTPsigma antibody
    • Protein tyrosine phosphatase receptor type S antibody
    • Protein tyrosine phosphatase receptor type sigma antibody
    • Ptprs antibody
    • PTPRS_HUMAN antibody
    • PTPSIGMA antibody
    • R PTP sigma antibody
    • R-PTP-S antibody
    • R-PTP-sigma antibody
    • Receptor-type tyrosine-protein phosphatase S antibody
    • Receptor-type tyrosine-protein phosphatase sigma antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for PTPRS with ab222798 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for PTPRS with ab222798 at 1/100 dilution in immunohistochemical analysis.

References

ab222798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up