Overview

  • Product name

  • Description

    Rabbit polyclonal to PU.1/Spi1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Pig
  • Immunogen

    Synthetic peptide corresponding to Human PU.1/Spi1 aa 217-246.
    Sequence:

    KGNRKKMTYQKMARALRNYGKTGEVKKVKK


    Database link: P17947

  • Positive control

    • WB: WiDr whole cell lysate. IHC-P: Human spleen tissue. ICC/IF: NIH/3T3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB 1/1000. Predicted molecular weight: 31 kDa.
ICC/IF 1/10 - 1/50.

Target

  • Function

    Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • transcription factor spi1 antibody
    • 31 kDa Transforming Protein antibody
    • 31 kDa-transforming protein antibody
    • cb1086 antibody
    • Hematopoietic transcription factor PU.1 antibody
    • OF antibody
    • oncogene spi1 antibody
    • PU.1 antibody
    • SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of antibody
    • SFPI1 antibody
    • si:by184l24.2 antibody
    • SPI 1 antibody
    • SPI 1 proto oncogene antibody
    • SPI A antibody
    • Spi1 antibody
    • SPI1_HUMAN antibody
    • Spleen focus forming virus (SFFV) proviral integration oncogene spi1 antibody
    • Spleen focus forming virus proviral integration oncogene spi1 antibody
    • Transcription factor PU.1 antibody
    see all

Images

  • Anti-PU.1/Spi1 antibody (ab230336) at 1/1000 dilution + WiDr cell lysate at 35 µg

    Developed using the ECL technique.

    Predicted band size: 31 kDa

  • Paraffin-embedded, formalin fixed human spleen tissue stained for PU.1/Spi1 using ab230336 at 5μg/ml in immunohistochemical analysis.

  • 4% paraformaldehyde fixed, 0.1% Triton X-100 permeabilized NIH/3T3 (mouse embryo fibroblast cell line) cells stained for PU.1/Spi1 using ab230336 at 1/25 dilution in ICC/IF.

References

ab230336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up