Overview

  • Product name

  • Description

    Rabbit polyclonal to PUF60/FIR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PUF60/FIR aa 302-413.
    Sequence:

    AVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTP GLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVN PILASPPTLGLL


    Database link: Q9UHX1

  • Positive control

    • WB: HeLa and MCF7 whole cell lysates. IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as PUF60

     

Properties

Applications

Our Abpromise guarantee covers the use of ab222897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 55,56,58,59,60 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    DNA- and RNA-binding protein, involved in several nuclear processes such as pre-mRNA splicing, apoptosis and transcription regulation. In association with FUBP1 regulates MYC transcription at the P2 promoter through the core-TFIIH basal transcription factor. Acts as a transcriptional repressor through the core-TFIIH basal transcription factor. Represses FUBP1-induced transcriptional activation but not basal transcription. Decreases ERCC3 helicase activity. Does not repress TFIIH-mediated transcription in xeroderma pigmentosum complementation group B (XPB) cells. Is also involved in pre-mRNA splicing. Promotes splicing of an intron with weak 3'-splice site and pyrimidine tract in a cooperative manner with U2AF2. Involved in apoptosis induction when overexpressed in HeLa cells. Isoform 6 failed to repress MYC transcription and inhibited FIR-induced apoptosis in colorectal cancer. Isoform 6 may contribute to tumor progression by enabling increased MYC expression and greater resistance to apoptosis in tumors than in normal cells. Modulates alternative splicing of several mRNAs. Binds to relaxed DNA of active promoter regions. Binds to the pyrimidine tract and 3'-splice site regions of pre-mRNA; binding is enhanced in presence of U2AF2. Binds to Y5 RNA in association with TROVE2. Binds to poly(U) RNA.
  • Tissue specificity

    Isoform 2 is expressed in colonic epithelium and colorectal epithelium cancer (at protein level). Isoform 6 is expressed in colorectal epithelial cancer but below detection level in colonic epithelium. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the RRM half pint family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Domain

    The third RNA recognition motif, called PUMP domain, is atypical and may rather mediate homodimerization and/or protein-protein interactions.
  • Cellular localization

    Nucleus. Colocalizes partially with TROVE2.
  • Information by UniProt
  • Database links

  • Alternative names

    • 60 kDa poly(U)-binding-splicing factor antibody
    • FBP-interacting repressor antibody
    • FIR antibody
    • FLJ31379 antibody
    • FUSE-binding protein-interacting repressor antibody
    • Poly U binding splicing factor 60KDa antibody
    • Poly(U) binding splicing factor 60 antibody
    • Poly(U)-binding-splicing factor PUF60 antibody
    • poly-U binding splicing factor PUF60 antibody
    • PUF60 antibody
    • PUF60_HUMAN antibody
    • pyrimidine tract binding splicing factor antibody
    • Ro ribonucleoprotein-binding protein 1 antibody
    • Ro-binding protein 1 antibody
    • RoBP1 antibody
    • RoBPI antibody
    • siah binding protein 1 antibody
    • Siah-binding protein 1 antibody
    • Siah-BP1 antibody
    • SIAHBP1 antibody
    see all

Images

  • All lanes : Anti-PUF60/FIR antibody (ab222897) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 55,56,58,59,60 kDa
    Observed band size: 60 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human kidney tissue stained for PUF60/FIR using ab222897 at 1/100 dilution in immunohistochemical analysis.

References

ab222897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up