Overview

  • Product name

  • Description

    Rabbit polyclonal to PUS10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PUS10 aa 162-252.
    Sequence:

    LVKQEMGKQSLSLGRDDIVQLKEAYKWITHPLFSEELGVPIDGKSLFEVS VVFAHPETVEDCHFLAAICPDCFKPAKNKQSVFTRMAVMKA


    Database link: Q3MIT2

  • Positive control

    • Human nasopharynx tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab184981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Pseudouridylate synthases catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. PUS10 catalyzes the formation of the universal psi55 in the GC loop of transfer RNAs (Probable). Modulator of TRAIL-induced cell death via activation of procaspase 8 and BID cleavage. Required for the progression of the apoptotic signal through intrinsic mitochondrial cell death.
  • Sequence similarities

    Belongs to the pseudouridine synthase Pus10 family.
  • Post-translational
    modifications

    Proteolytically cleaved during TRAIL-induced cell death. Cleaved, in vitro, either by caspase-3 or caspase-8.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCDC139 antibody
    • Coiled coil domain containing 139 antibody
    • Coiled coil domain containing protein 139 antibody
    • Coiled-coil domain-containing protein 139 antibody
    • DOBI antibody
    • FLJ32312 antibody
    • MGC126729 antibody
    • Pseudouridine synthase 10 antibody
    • Pseudouridylate synthase 10 antibody
    • Psi55 synthase antibody
    • pus10 antibody
    • PUS10_HUMAN antibody
    • Putative tRNA pseudouridine synthase Pus10 antibody
    • tRNA pseudouridine 55 synthase antibody
    • tRNA pseudouridylate synthase antibody
    • tRNA uridine isomerase antibody
    • tRNA-uridine isomerase antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human nasopharynx tissue, labeling PUS10 with ab184981 at 1/50 dilution.

References

ab184981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up