Anti-PXDN antibody - N-terminal (ab179663)

Overview

  • Product name
    Anti-PXDN antibody - N-terminal
  • Description
    Rabbit polyclonal to PXDN - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Dog, Pig
  • Immunogen

    Synthetic peptide within Human PXDN aa 111-160 (N terminal). The exact sequence is proprietary.
    Sequence:

    NLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKL


    Database link: Q92626-2

  • Positive control
    • COLO205 whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa.

Target

Images

  • Anti-PXDN antibody - N-terminal (ab179663) at 1 µg/ml + COLO205 whole cell lysate at 10 µg

    Predicted band size: 80 kDa

References

ab179663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Rat Cell lysate - whole cell (H9C2 myoblasts)
Gel Running Conditions
Reduced Denaturing (4–15% gel)
Loading amount
6 µg
Treatment
PXDN siliencing RNA 20 nM 48 hrs and 72 hrs
Specification
H9C2 myoblasts
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jan 17 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up