Overview

  • Product name

    Anti-PXDN/VPO1 antibody - N-terminal
  • Description

    Rabbit polyclonal to PXDN/VPO1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Dog, Pig
  • Immunogen

    Synthetic peptide within Human PXDN/VPO1 aa 111-160 (N terminal). The exact sequence is proprietary.
    Sequence:

    NLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKL


    Database link: Q92626-2

  • Positive control

    • COLO205 whole cell lysate.
  • General notes

     This product was previously labelled as PXDN

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa.

Target

Images

  • Anti-PXDN/VPO1 antibody - N-terminal (ab179663) at 1 µg/ml + COLO205 whole cell lysate at 10 µg

    Predicted band size: 80 kDa

References

This product has been referenced in:

  • Gazdhar A  et al. Alpha-Klotho Enrichment in Induced Pluripotent Stem Cell Secretome Contributes to Antioxidative Protection in Acute Lung Injury. Stem Cells 36:616-625 (2018). Read more (PubMed: 29226550) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Western blot
Sample
Rat Cell lysate - whole cell (H9C2 myoblasts)
Gel Running Conditions
Reduced Denaturing (4–15% gel)
Loading amount
6 µg
Treatment
PXDN siliencing RNA 20 nM 48 hrs and 72 hrs
Specification
H9C2 myoblasts
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 17 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up