Overview

  • Product name

  • Description

    Rabbit polyclonal to PYCR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human PYCR1 aa 269-319 (C terminal). The exact sequence is proprietary.
    Sequence:

    QSMADQEQVSPAAIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGK D


    Database link: P32322

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab206693 was affinity purified using an epitope specific to PYCR1 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 33 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Relevance

      PYCR1 is an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. It forms a homopolymer and localizes to the mitochondrion.
    • Cellular localization

      Mitochondrial
    • Database links

    • Alternative names

      • P5C antibody
      • P5C reductase 1 antibody
      • P5C reductase antibody
      • P5CR 1 antibody
      • P5CR antibody
      • PIG45 antibody
      • PP222 antibody
      • Proliferation inducing protein 45 antibody
      • PYCR 1 antibody
      • PYCR antibody
      • Pyrroline 5 carboxylate reductase 1 antibody
      • Pyrroline 5 carboxylate reductase 1 mitochondrial antibody
      see all

    Images

    • All lanes : Anti-PYCR1 antibody (ab206693) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 33 kDa


      Exposure time: 30 seconds


      Lysates prepared using NETN lysis buffer.

    References

    ab206693 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab206693.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up