Overview

  • Product name

  • Description

    Rabbit polyclonal to PYGL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PYGL aa 714-832.
    Sequence:

    MRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDII NMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFS SDRTIKEYAQNIWNVEPSD


    Database link: P06737

  • Positive control

    • WB: U-251 MG cell lysate. IHC-P: Human liver tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/250 - 1/500. Predicted molecular weight: 97 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
  • Involvement in disease

    Defects in PYGL are the cause of glycogen storage disease type 6 (GSD6) [MIM:232700]. A metabolic disorder characterized by mild to moderate hypoglycemia, mild ketosis, growth retardation, and prominent hepatomegaly. Heart and skeletal muscle are not affected.
  • Sequence similarities

    Belongs to the glycogen phosphorylase family.
  • Post-translational
    modifications

    Phosphorylation of Ser-15 converts phosphorylase B (unphosphorylated) to phosphorylase A.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glycogen phosphorylase antibody
    • Glycogen phosphorylase L antibody
    • Glycogen phosphorylase liver antibody
    • Glycogen phosphorylase liver form antibody
    • GSD6 antibody
    • Hers disease, glycogen storage disease type VI antibody
    • liver form antibody
    • OTTHUMP00000233649 antibody
    • OTTHUMP00000233651 antibody
    • Phosphorylase glycogen liver antibody
    • Pygl antibody
    • PYGL_HUMAN antibody
    see all

Images

  • Anti-PYGL antibody (ab223788) at 1/250 dilution + U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 97 kDa

  • Paraffin-embedded human liver tissue stained for PYGL using ab223788 at 1/500 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for PYGL (green) using ab223788 at 4 µg/ml in ICC/IF.

References

ab223788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up