Overview

  • Product name

  • Description

    Rabbit polyclonal to PYGM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Rabbit, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse PYGM aa 11-187. Expressed in E.coli.
    Sequence:

    RKQISVRGLAGVENVSELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACD EATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGI RYEFGIFNQKICGGWQMEEADDWLRYG


    Database link: Q9WUB3

  • Positive control

    • WB: Recombinant mouse PYGM protein; mouse skeletal muscle and liver lysates; rat skeletal muscle lysate; HepG2 whole cell lysate (ab7900). IHC-P: Mouse skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 97 kDa.

Target

  • Function

    Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
  • Involvement in disease

    Defects in PYGM are the cause of glycogen storage disease type 5 (GSD5) [MIM:232600]; also known as McArdle disease. GSD5 is a metabolic disorder resulting in myopathy characterized by exercise intolerance, cramps, muscle weakness and recurrent myoglobinuria.
  • Sequence similarities

    Belongs to the glycogen phosphorylase family.
  • Post-translational
    modifications

    Phosphorylation of Ser-15 converts phosphorylase B (unphosphorylated) to phosphorylase A.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glycogen phosphorylase antibody
    • Glycogen phosphorylase muscle form antibody
    • muscle form antibody
    • Muscpho antibody
    • Myophosphorylase antibody
    • Phosphorylase glycogen muscle (McArdle syndrome glycogen storage disease type V) antibody
    • Pygm antibody
    • PYGM_HUMAN antibody
    see all

Images

  • Anti-PYGM antibody (ab231963) at 2 µg/ml + Recombinant mouse PYGM protein

    Predicted band size: 97 kDa

  • Anti-PYGM antibody (ab231963) at 2 µg/ml + Mouse skeletal muscle lysate

    Predicted band size: 97 kDa

  • Anti-PYGM antibody (ab231963) at 2 µg/ml + Rat skeletal muscle lysate

    Predicted band size: 97 kDa

  • Anti-PYGM antibody (ab231963) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 97 kDa

  • Anti-PYGM antibody (ab231963) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 97 kDa

  • Formalin-fixed, paraffin-embedded mouse skeletal muscle tissue stained for PYGM using ab231963 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up