Overview

  • Product name
  • Description
    Rabbit polyclonal to Pyrin
  • Host species
    Rabbit
  • Specificity
    This antibody recognizes MEFV
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow, Dog
  • Immunogen

    Synthetic peptide within Human Pyrin aa 4-53 (N terminal). The exact sequence is proprietary.
    Sequence:

    TPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKM


    Database link: O15553

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab49121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.625 µg/ml. Predicted molecular weight: 86 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay was 1:62500.

Target

  • Function
    Probably controls the inflammatory response in myelomonocytic cells at the level of the cytoskeleton organization.
  • Tissue specificity
    Expressed in peripheral blood leukocytes, particularly in mature granulocytes and to a lesser extent in monocytes but not in lymphocytes. Detected in spleen, lung and muscle, probably as a result of leukocyte infiltration in these tissues. Not expressed in thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, liver, kidney, pancreas. Expression detected in several myeloid leukemic, colon cancer, and prostate cancer cell lines.
  • Involvement in disease
    Defects in MEFV are the cause of familial Mediterranean fever autosomal recessive (ARFMF) [MIM:249100]. ARFMF is an inherited disorder characterized by recurrent episodic fever, serosal inflammation and pain in the abdomen, chest or joints. ARFMF is frequently complicated by amyloidosis, which leads to renal failure and can be prophylactically treated with colchicine. ARFMF primarily affects ancestral ethnic groups living around the Mediterranean basin: North African Jews, Armenians, Arabs and Turks. The disease is also distributed in other populations including Greeks, Cypriots, Italians and Spanish, although at a lower prevalence.
    Defects in MEFV are the cause of familial Mediterranean fever autosomal dominant (ADFMF) [MIM:134610]. ADFMF is characterized by periodic fever, serosal inflammation and pain in the abdomen, chest or joints as seen also in the autosomal recessive form of the disease. It is associated with renal amyloidosis and characterized by colchicine unresponsiveness.
  • Sequence similarities
    Contains 1 B box-type zinc finger.
    Contains 1 B30.2/SPRY domain.
    Contains 1 DAPIN domain.
  • Developmental stage
    First detected in bone marrow promyelocytes. Expression increases throughout myelocyte differentiation and peaks in the mature myelomonocytic cells.
  • Cellular localization
    Nucleus and Cytoplasm > cytoskeleton. Associated with microtubules and with the filamentous actin of perinuclear filaments and peripheral lamellar ruffles.
  • Information by UniProt
  • Database links
  • Alternative names
    • FMF antibody
    • Marenostrin antibody
    • Mediterranean fever antibody
    • Mediterranean fever protein antibody
    • MEF antibody
    • Mefv antibody
    • MEFV_HUMAN antibody
    • Pyrin antibody
    • TRIM20 antibody
    see all

Images

  • Lane 1 : Marker
    Lane 2 : Anti-Pyrin antibody (ab49121) at 0.625 µg/ml

    Lane 2 : HepG2 cell lysate at 10 µg with 5% skimmed milk in PBS.

    Secondary
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 86 kDa
    Observed band size: 86 kDa



    Gel concentration 12%

References

ab49121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Answer

Thank you for for contacting us. I am sorry to hear this antibody is not providing satisfactory results.


Having reviewed the protocol details, I believe this product should have given satisfactory results. It appears that your customermay have received a faulty vial.

I apologize for the inconvenience and am pleased to offer them a free of charge replacement or credit note in compensation.

Thank you for your cooperation. I look forward to hearing from you with details of how you would like to proceed.

Read More

Answer

Thank you fro clarifying that information.


Having reviewed the protocol provided by your customer there are a few suggestions I can make in order to improve the performance of anti-MEFV antibody (ab49121).


1. Typically 1%Triton Xis used in the RIPA lysis buffer in order to aid in disrupting the membranes of the cell. This level of detergent is not however recommended to be used in the diluent or washing buffers at it can lead to stripping the antibody from the membrane.I would therefore suggest just using TBS (without any detergent added) for dilution of the primary and secondary antibody and 0.1% Tween in the wash buffer used.


2. If you have HepG2 cells available these can be used as a positive control.

Should the suggestions not improve the results, please do let me know.

In the event that a product is not functioning in the species and applications cited on the product datasheet (and the problem has been reported within 6 months of purchase), we would be pleased to provide a free of charge replacement, credit note, or refund.

I hope this information is helpful, and I thank you for your cooperation.

Read More

Question
Answer

Thank you fro contacting us and reporting the problems your customer has been experiencing with Anti-MEFV antibody (ab49121).


In order to understand this case a little further, could you please clarify what the 1% TBSTsolution is made up of?


Many thanks for your cooperation.

Read More

Answer

Thank you for contacting us. We have no FACS data for detection of MEFV, or data from other applications that detect MEFV in its native conformation, only western blot detection of denatured samples and ELISA against the immunogen peptide. These are the only two applications to which our guarantee applies, western blotting and ELISA. Still, the antibody may be effective in FACS, if the region that the antibody is raised against, the N terminus, is available for the antibody to recognize, and is not folded within the native conformation. You will need to fix and permeabilize the cells, as the protein is intracellular. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up