
  • Product name

    Anti-QKI antibody [EPR7306]
    See all QKI primary antibodies
  • Description

    Rabbit monoclonal [EPR7306] to QKI
  • Host species

  • Tested applications

    Suitable for: WB, IP, ICC/IFmore details
    Unsuitable for: Flow Cyt
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human QKI aa 250 to the C-terminus. The exact sequence is proprietary.
    Database link: Q96PU8

  • Positive control

    • Neuro 2a, HeLa and K562 cell lysates.
  • General notes

    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMab® patents.

    We are constantly working hard to ensure we provide our customers with best in class antibodies. As a result of this work we are pleased to now offer this antibody in purified format. We are in the process of updating our datasheets. The purified format is designated 'PUR' on our product labels. If you have any questions regarding this update, please contact our Scientific Support team.

    This product is a recombinant rabbit monoclonal antibody.



Our Abpromise guarantee covers the use of ab126742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/10000. Detects a band of approximately 38 kDa (predicted molecular weight: 37 kDa).
IP 1/10 - 1/100.
ICC/IF 1/50 - 1/100.
  • Application notes
    Is unsuitable for Flow Cyt.
  • Target

    • Function

      RNA-binding protein that plays a central role in myelinization (PubMed:16641098). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability (PubMed:23630077). In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia (PubMed:16641098). Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
    • Tissue specificity

      Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
    • Sequence similarities

      Contains 1 KH domain.
    • Domain

      The KH domain and the Qua2 region are involved in RNA binding.
    • Post-translational

      Methylated by PRMT1.
      Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA.
    • Cellular localization

      Nucleus. Cytoplasm.
    • Information by UniProt
    • Database links

    • Alternative names

      • DKFZp586I0923 antibody
      • HKQ antibody
      • Homolog of mouse quaking QKI KH domain RNA binding protein antibody
      • Hqk antibody
      • HQK1 antibody
      • HqkI antibody
      • OTTHUMP00000017581 antibody
      • OTTHUMP00000017582 antibody
      • OTTHUMP00000017583 antibody
      • Protein quaking antibody
      • QK antibody
      • QK1 antibody
      • QK3 antibody
      • QKI antibody
      • QKI_HUMAN antibody
      • QKI1 antibody
      • Quaking homolog antibody
      • Quaking homolog KH domain RNA binding antibody
      • Quaking homolog KH domain RNA binding mouse antibody
      • Quaking isoform 1 antibody
      • Quaking protein antibody
      • RNA binding protein HQK antibody
      see all


    • All lanes : Anti-QKI antibody [EPR7306] (ab126742) at 1/2000 dilution (purified)

      Lane 1 : HeLa (Human cervix adenocarcinoma epithelial cell) whole cell lysates
      Lane 2 : Neuro-2a (Mouse neuroblastoma neuroblast) whole cell lysates

      Lysates/proteins at 20 µg per lane.

      All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

      Predicted band size: 37 kDa

      Blocking and diluting buffer : 5% NFDM/TBST
    • ab126742 (purified) at 1:30 dilution (2µg) immunoprecipitating QKI in HeLa whole cell lysate.
      Lane 1 (input): HeLa (Human cervix adenocarcinoma epithelial cell) whole cell lysate 10µg
      Lane 2 (+): ab126742 & HeLa whole cell lysate
      Lane 3 (-): Rabbit monoclonal IgG (ab172730) instead of ab126742 in HeLa whole cell lysate
      For western blotting, VeriBlot for IP Detection Reagent (HRP) (ab131366) was used for detection at 1:1000 dilution.
      Blocking and diluting buffer: 5% NFDM/TBST.

    • Immunocytochemistry/ Immunofluorescence analysis of Neuro-2a (Mouse neuroblastoma neuroblast) cells labeling QKI with Purified ab126742 at 1:100 dilution (5.6μg/ml). Cells were fixed in 4% Paraformaldehyde and permeabilized with 0.1% tritonX-100. Ab150077 Goat anti rabbit IgG(Alexa Fluor® 488) was used as the secondary antibody at 1:1000 dilution. DAPI nuclear counterstain. PBS instead of the primary antibody was used as the secondary antibody only control.

    • All lanes : Anti-QKI antibody [EPR7306] (ab126742) at 1/1000 dilution (unpurified)

      Lane 1 : Neuro 2a cell lysate
      Lane 2 : HeLa cell lysate
      Lane 3 : K562 cell lysate

      Lysates/proteins at 10 µg per lane.

      All lanes : Goat-anti-rabbit HRP at 1/2000 dilution

      Developed using the ECL technique.

      Predicted band size: 37 kDa
      Observed band size: 38 kDa
      why is the actual band size different from the predicted?

    • Equilibrium disassociation constant (KD)
      Learn more about KD

      Click here to learn more about KD


    This product has been referenced in:

    • Zhang X  et al. Circular RNA circNRIP1 acts as a microRNA-149-5p sponge to promote gastric cancer progression via the AKT1/mTOR pathway. Mol Cancer 18:20 (2019). Read more (PubMed: 30717751) »
    • Ramanathan M  et al. RNA-protein interaction detection in living cells. Nat Methods 15:207-212 (2018). Read more (PubMed: 29400715) »
    See all 8 Publications for this product

    Customer reviews and Q&As

    1-3 of 3 Abreviews or Q&A

    Western blot
    Mouse Recombinant protein (COS-7 monkey cells transfected with mouse QKI)
    Gel Running Conditions
    Reduced Denaturing (18%)
    Loading amount
    200000 cells
    COS-7 monkey cells transfected with mouse QKI
    Blocking step
    Odyssey blocking buffer (927-50000) 1:1 in PBS as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 23°C

    Abcam user community

    Verified customer

    Submitted May 20 2015


    Thank you for contacting us.Jeremy is out of the office today, but I’d be happy to help with your inquiry. My name is Keith.

    In regards to the immunogen sequence which you have requested. Ab78130 is specific for QK1 isoform 1, known also asHQK-5 or QKI-5. Ab78518 is directed against isoform 4 otherwise known asHQK-7.

    Though I have been unable to find the exact immunogen used to create these products, the HQK-7isoform differs from the canonical (HQK-5, sequence as follows:
    http://www.uniprot.org/blast/?about=Q96PU8[312-341]: GAVATKVRRHDMRVHPYQRIVTADRAATGN→EWIEMPVMPDISAH Therefore the immunogen specific to this product should be within this region.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!

    Read More


    Thanks for your enquiry.

    I have passed your enquiry regarding the immunogen sequence for ab78518 on to the lab. I will forward you any information I receive.

    The concentration of these 3 antibodies has not been determined. ab78518 and ab78130is not determined. These are both whole antiserum products and not purified antibodies. However, estimated concentrationof specific primary antibody for whole serum products is about 0.5mg/ml. And ab126742is a tissue culture supernatant product. This is also not a purified antibody and the specific antibody concentration in this sort of productis typically 0.05mg/ml.

    Regarding your interest in a bulk order purchase, I recommend contacting our bulk order specialist who can offer you the appropriate discount. Please email your bulk order request to mailto:sales@abcam.com with attention to Andrea Gray.

    I hope this is helpful. Please let me know if you have any further questions.

    Read More

    For licensing inquiries, please contact partnerships@abcam.com

    Sign up