Overview

  • Product name

    Anti-QKI antibody [N147/6]
    See all QKI primary antibodies
  • Description

    Mouse monoclonal [N147/6] to QKI
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, IHC-Fr, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Fusion protein corresponding to Human QKI aa 1-341.
    Sequence:

    MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIS RVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVG RILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNED LHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL NGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPT IMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN


    Database link: Q96PU8

  • Positive control

    • WB: Rat brain membrane lysate. ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S147-6 to N147/6, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/1000. Detects a band of approximately 36-38 kDa (predicted molecular weight: 38 kDa).
IHC-Fr Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    RNA-binding protein that plays a central role in myelinization (PubMed:16641098). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability (PubMed:23630077). In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia (PubMed:16641098). Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
  • Tissue specificity

    Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
  • Sequence similarities

    Contains 1 KH domain.
  • Domain

    The KH domain and the Qua2 region are involved in RNA binding.
  • Post-translational
    modifications

    Methylated by PRMT1.
    Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp586I0923 antibody
    • HKQ antibody
    • Homolog of mouse quaking QKI KH domain RNA binding protein antibody
    • Hqk antibody
    • HQK1 antibody
    • HqkI antibody
    • OTTHUMP00000017581 antibody
    • OTTHUMP00000017582 antibody
    • OTTHUMP00000017583 antibody
    • Protein quaking antibody
    • QK antibody
    • QK1 antibody
    • QK3 antibody
    • QKI antibody
    • QKI_HUMAN antibody
    • QKI1 antibody
    • Quaking homolog antibody
    • Quaking homolog KH domain RNA binding antibody
    • Quaking homolog KH domain RNA binding mouse antibody
    • Quaking isoform 1 antibody
    • Quaking protein antibody
    • RNA binding protein HQK antibody
    see all

Images

  • SK-N-BE (Human neuroblastoma cell line) cells stained for QKI using ab186245 at a dilution of 1/100 in ICC/IF.

    Cells were fixed in 4% formaldehyde for 15 minutes at RT.

    Secondary used is a Goat Anti-Mouse ATTO 488 at 1:100 dilution for 60 minutes at RT.

  • Anti-QKI antibody [N147/6] (ab186245) at 1/200 dilution + Rat brain membrane lysate at 15 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/1000 dilution

    Developed using the ECL technique.

    Predicted band size: 38 kDa


    Exposure time: 6 minutes


    Block: 2% BSA and 2% Skimmed milk in 1X TBST.

    Primary antibody incubated for 16 hours at +4°C.

    Secondary antibody incubated for 1 hour at RT.

References

ab186245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up