Overview

  • Product name

  • Description

    Rabbit polyclonal to QRSL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Dog, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human QRSL aa 289-528.
    Sequence:

    ELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLCTSEVASN MARFDGLQYGHRCDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKEN YENYFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEAVPYLEFIKEDN RTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLL TVAKWFEKQVQFPVIQLQELMDDCSAVLENEKLASVSLKQ


    Database link: Q9H0R6

  • Positive control

    • WB: HeLa and MCF7 whole cell lysate. IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 57 kDa (predicted molecular weight: 57, 32 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    QRSL belongs to the amidase family. Catalytic activity: ATP + L-glutamyl-tRNA(Gln) + L-glutamine = ADP + phosphate + L-glutaminyl-tRNA(Gln) + L-glutamate. There are two named isoforms.
  • Database links

  • Alternative names

    • 2700038P16Rik antibody
    • C80053 antibody
    • DKFZp564C1278 antibody
    • FLJ10989 antibody
    • FLJ12189 antibody
    • FLJ13447 antibody
    • GatA antibody
    • Glutaminyl tRNA synthase (glutamine hydrolyzing) like 1 antibody
    • Glutaminyl tRNA synthase like protein 1 antibody
    • Glutamyl tRNA(Gln) amidotransferase subunit A, mitochondrial antibody
    • MGC105526 antibody
    • OTTMUSP00000026615 antibody
    see all

Images

  • All lanes : Anti-QRSL antibody (ab230268) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 57, 32 kDa
    Observed band size: 57 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human small intestine tissue stained for QRSL using ab230268 at 1/100 dilution in immunohistochemical analysis.

References

ab230268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up