Overview

  • Product name

    Anti-QSOX2 antibody - C-terminal
    See all QSOX2 primary antibodies
  • Description

    Rabbit polyclonal to QSOX2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human QSOX2 aa 648-698 (C terminal). The exact sequence is proprietary. (NP_859052.3).
    Sequence:

    AAPFLGVDFSSLDMSLCVVLYVASSLFLMVMYFFFRVRSRRWKVKHHHPA V


    Database link: Q6ZRP7

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab191168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/500 - 1/2500. Predicted molecular weight: 78 kDa.

Target

  • Function

    Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins. Also seems to play a role in regulating the sensitization of neuroblastoma cells for interferon-gamma-induced apoptosis.
  • Tissue specificity

    Expressed in pancreas, brain, placenta, kidney, heart and fetal tissues. Weakly expressed in lung, liver and skeletal muscles.
  • Sequence similarities

    Belongs to the quiescin-sulfhydryl oxidase (QSOX) family.
    Contains 1 ERV/ALR sulfhydryl oxidase domain.
    Contains 1 thioredoxin domain.
  • Cellular localization

    Membrane. Secreted. Cell membrane. Nucleus membrane. Seems to be predominantly targeted to the nuclear and outer plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp762A2013 antibody
    • Neuroblastoma-derived sulfhydryl oxidase antibody
    • QSCN6L1 antibody
    • QSOX2 antibody
    • QSOX2_HUMAN antibody
    • Quiescin Q6 like 1 antibody
    • Quiescin Q6 sulfhydryl oxidase 2 antibody
    • Quiescin Q6-like protein 1 antibody
    • SOXN antibody
    • Sulfhydryl oxidase 2 antibody
    see all

Images

  • All lanes : Anti-QSOX2 antibody - C-terminal (ab191168) at 1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 78 kDa


    Exposure time: 3 minutes


    Lysates prepared using RIPA lysis buffer.

  • Detection of QSOX2 in immunoprecipitates of HeLa whole cell lysate prepared using RIPA lysis buffer (1 mg for IP, 20% of IP loaded) using ab191168 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab191168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up