Anti-QTRTD1 antibody (ab247002)
Key features and details
- Rabbit polyclonal to QTRTD1
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-QTRTD1 antibody -
Description
Rabbit polyclonal to QTRTD1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human QTRTD1 aa 246-324.
Sequence:DKPRLISGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFSFDYQPN PEETLLQQNGTQEEIKCMDQIKKIETTGC
Database link: Q9H974 -
Positive control
- WB: RT4 whole cell lysate. IHC-P: Human colon tissue. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab247002 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 47 kDa. | |
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Interacts with QTRT1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine). -
Pathway
tRNA modification; tRNA-queuosine biosynthesis. -
Sequence similarities
Belongs to the queuine tRNA-ribosyltransferase family. QTRTD1 subfamily. -
Cellular localization
Cytoplasm. Mitochondrion. May associate with the mitochondrion outer membrane. - Information by UniProt
-
Database links
- Entrez Gene: 79691 Human
- SwissProt: Q9H974 Human
- Unigene: 477162 Human
-
Alternative names
- FLJ12960 antibody
- QTRD1_HUMAN antibody
- qtrtd1 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for QTRTD1 (green) using ab247002 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-QTRTD1 antibody (ab247002)Paraffin-embedded human colon tissue stained for QTRTD1 using ab247002 at 1/200 dilution in immunohistochemical analysis.
-
Anti-QTRTD1 antibody (ab247002) at 0.4 µg/ml + RT4 (human urinary bladder cancer cell line) whole cell lysate
Predicted band size: 47 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247002 has not yet been referenced specifically in any publications.