Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human RAB aa 213-340.
    Sequence:

    PQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTAS HSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVS KVSTNKAGLQTADKYAALANLDNIFSAG


    Database link: P52594

  • Positive control

    • WB: RT4 and U-251 MG cell lysates. IHC-P: Human placenta tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as AGFG1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 58 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for vesicle docking or fusion during acrosome biogenesis (By similarity). May play a role in RNA trafficking or localization. In case of infection by HIV-1, acts as a cofactor for viral Rev and promotes movement of Rev-responsive element-containing RNAs from the nuclear periphery to the cytoplasm. This step is essential for HIV-1 replication.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 1 Arf-GAP domain.
  • Domain

    Contains FG repeats. The FG repeat region is required for acting as a cofactor of HIV-1 Rev.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Nucleus. Cytoplasmic vesicle.
  • Information by UniProt
  • Database links

  • Alternative names

    • AGFG1 antibody
    • AGFG1_HUMAN antibody
    • Arf-GAP domain and FG repeats-containing protein 1 antibody
    • ArfGAP with FG repeats 1 antibody
    • AU045498 antibody
    • C130049H11Rik antibody
    • C85612 antibody
    • D730048C23Rik antibody
    • DKFZp686I15205 antibody
    • HIV 1 Rev binding protein antibody
    • HIV-1 Rev-binding protein antibody
    • HRB antibody
    • MGC116375 antibody
    • MGC116938 antibody
    • MGC116940 antibody
    • Nucleoporin like protein RIP antibody
    • Nucleoporin-like protein RIP antibody
    • RAB antibody
    • Rev interacting protein antibody
    • Rev-interacting protein antibody
    • Rev/Rex activation domain-binding protein antibody
    • RIP antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RAB (green) using ab244307 at 4 µg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for RAB using ab244307 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-RAB antibody (ab244307) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate

    Predicted band size: 58 kDa

  • All lanes : Anti-RAB antibody (ab244307) at 0.4 µg/ml

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 58 kDa

References

ab244307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up