Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab11A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Rab11A aa 1-216.
    Sequence:

    MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT RSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLT YENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKN GLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ MSDRRENDMSPSNN VVPIHVPPTTENKPKVQCCQNI


    Database link: P62491

  • Positive control

    • Human spleen extract; Jurkat, MCF7 and SH-SYSY cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab180778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Regulates endocytic recycling. May exert its functions by interacting with multiple effector proteins in different complexes. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis (By similarity). Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane. Recycling endosome membrane. Cleavage furrow. Translocates with RAB11FIP2 from the vesicles of the endocytic recycling compartment (ERC) to the plasma membrane. Localizes to the cleavage furrow. Colocalizes with PARD3, PRKCI, EXOC5, OCLN, PODXL and RAB8A in apical membrane initiation sites (AMIS) during the generation of apical surface and luminogenesis.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC1490 antibody
    • Rab 11 antibody
    • Rab 11A antibody
    • RAB 11A, member oncogene family antibody
    • Rab-11 antibody
    • RAB11 A antibody
    • RAB11 antibody
    • Rab11a antibody
    • RAB11A member RAS oncogene family antibody
    • Ras related protein Rab 11A antibody
    • Ras related protein Rab11A antibody
    • Ras-related protein Rab-11A antibody
    • RB11A_HUMAN antibody
    • YL 8 antibody
    • YL8 antibody
    see all

Images

  • All lanes : Anti-Rab11A antibody (ab180778) at 1/500 dilution

    Lane 1 : Human spleen extract
    Lane 2 : Jurkat cell extract
    Lane 3 : MCF7 cell extract
    Lane 4 : SY-SHSH cell extract

    Predicted band size: 24 kDa

References

This product has been referenced in:

  • Shimura M  et al. A novel liver metastasis-correlated protein of pancreatic neuroendocrine neoplasm (PanNEN) discovered by proteomic analysis. Oncotarget 9:24291-24303 (2018). Read more (PubMed: 29849941) »
See 1 Publication for this product

Customer reviews and Q&As

Abreviews
Application
Western blot
Loading amount
40 µg
Gel Running Conditions
Reduced Denaturing (12% SDS-PAGE)
Sample
Marmoset (common) Tissue lysate - whole (brain)
Specification
brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Jun 10 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up