Anti-Rab18 antibody (ab224466)
Key features and details
- Rabbit polyclonal to Rab18
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Rab18 antibody
See all Rab18 primary antibodies -
Description
Rabbit polyclonal to Rab18 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human Rab18 aa 87-205.
Sequence:VYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEG LKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVK LSHREEGQGGGACGGYCSV
Database link: Q9NP72 -
Positive control
- IHC-P: Human prostate tissue. WB: Rab18 overexpression HEK-293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 23 kDa. |
Target
-
Function
Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 420483 Chicken
- Entrez Gene: 511160 Cow
- Entrez Gene: 22931 Human
- Entrez Gene: 19330 Mouse
- Entrez Gene: 100174695 Orangutan
- Entrez Gene: 307039 Rat
- Omim: 602207 Human
- SwissProt: Q5ZLG1 Chicken
see all -
Alternative names
- AA959686 antibody
- RAB18 antibody
- RAB18 small GTPase antibody
see all
Images
-
Western blot - Anti-Rab18 antibody (ab224466)All lanes : Anti-Rab18 antibody (ab224466) at 1/100 dilution
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : Rab18 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) co-expressed with a C-terminal myc-DDK tag, cell lysate
Developed using the ECL technique.
Predicted band size: 23 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab18 antibody (ab224466)Paraffin-embedded human prostate tissue stained for Rab18 using ab224466 at 1/200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224466 has not yet been referenced specifically in any publications.
