Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab18
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Rab18 aa 87-205.
    Sequence:

    VYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEG LKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVK LSHREEGQGGGACGGYCSV


    Database link: Q9NP72

  • Positive control

    • IHC-P: Human prostate tissue. WB: Rab18 overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 23 kDa.

Target

Images

  • All lanes : Anti-Rab18 antibody (ab224466) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Rab18 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) co-expressed with a C-terminal myc-DDK tag, cell lysate

    Developed using the ECL technique.

    Predicted band size: 23 kDa

  • Paraffin-embedded human prostate tissue stained for Rab18 using ab224466 at 1/200 dilution in immunohistochemical analysis.

References

ab224466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up