Anti-Rab18 antibody (ab224466)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Rab18 antibody
See all Rab18 primary antibodies -
Description
Rabbit polyclonal to Rab18 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human Rab18 aa 87-205.
Sequence:VYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEG LKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVK LSHREEGQGGGACGGYCSV
Database link: Q9NP72 -
Positive control
- IHC-P: Human prostate tissue. WB: Rab18 overexpression HEK-293T cell lysate.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/100 - 1/250. Predicted molecular weight: 23 kDa. |
Target
-
Function
Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 420483 Chicken
- Entrez Gene: 511160 Cow
- Entrez Gene: 22931 Human
- Entrez Gene: 19330 Mouse
- Entrez Gene: 100174695 Orangutan
- Entrez Gene: 307039 Rat
- Omim: 602207 Human
- SwissProt: Q5ZLG1 Chicken
see all -
Alternative names
- AA959686 antibody
- RAB18 antibody
- RAB18 small GTPase antibody
see all
Images
-
All lanes : Anti-Rab18 antibody (ab224466) at 1/100 dilution
Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : Rab18 overexpression HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) co-expressed with a C-terminal myc-DDK tag, cell lysate
Developed using the ECL technique.
Predicted band size: 23 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Rab18 antibody (ab224466)
Paraffin-embedded human prostate tissue stained for Rab18 using ab224466 at 1/200 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab224466 has not yet been referenced specifically in any publications.