Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human RAB1B aa 130-201.
    Sequence:

    VVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAAS GGERPNLKIDSTPVKPAGGGCC


    Database link: Q9H0U4

  • Positive control

    • ICC/IF: U-251 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Protein transport. Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications

    Prenylated; by GGTase II, only after interaction of the substrate with Rab escort protein 1 (REP1).
    AMPylation at Tyr-77 occurs in the switch 2 region and leads to moderate inactivation of the GTPase activity. It appears to prolong the lifetime of the GTP state of RAB1B by restricting access of GTPase effectors to switch 2 and blocking effector-stimulated GTP hydrolysis, thereby rendering RAB1B constitutively active.
  • Cellular localization

    Membrane. Cytoplasm. Targeted by REP1 to membranes of specific subcellular compartments including endoplasmic reticulum, Golgi apparatus, and intermediate vesicles between these two compartments. In the GDP-form, colocalizes with GDI in the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • RAB1B antibody
    • RAB1B member RAS oncogene family antibody
    • RAB1B_HUMAN antibody
    • Ras related protein Rab1B antibody
    • Ras-related protein Rab-1B antibody
    • Small GTP binding protein antibody
    see all

Images

  • U-251 (human brain glioma cell line) cells stained for RAB1B (green) using ab234717 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab234717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up