Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Rab20 aa 39-223. Genbank: BC026025
    Sequence:

    GAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSL VELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAG DRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGY NVDLLFETLFDLVVPMILQQRAERPSHTVDISSHK


    Database link: Q9NX57

  • Positive control

    • HeLa and MCF7 cell lysates. Human prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 26 kDa.

Target

  • Function

    Plays a role in apical endocytosis/recycling. Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes.
  • Tissue specificity

    Low or absent expression in normal pancreas and stronger expression in 15 of 18 exocrine pancreatic adenocarcinomas (at protein level).
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Golgi apparatus. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane. Highly enriched on apical endocytic structures in polarized epithelial cells of kidney proximal tubules (By similarity). Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211).
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20429 antibody
    • RAB20 antibody
    • RAB20 member RAS oncogene family antibody
    • RAB20_HUMAN antibody
    • Ras related protein Rab20 antibody
    • Ras-related protein Rab-20 antibody
    see all

Images

  • All lanes : Anti-Rab20 antibody (ab197209) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : MCF7 cell lysate

    Predicted band size: 26 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human prostate cancer tissue labeling Rab20 with ab197209 at a 1/100 dilution.

References

ab197209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up