Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB21
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human RAB21 aa 94-217.
    Sequence:

    GAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVS IQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGN GSSQPGTARRGVQIIDDEPQAQTS


    Database link: Q9UL25

  • Positive control

    • IHC-P: Human colon tissue. WB: RAB21 overexpression HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab224390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 24 kDa.

Target

  • Function

    Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general. As a result, may regulate cell adhesion and migration (By similarity). During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis.
  • Tissue specificity

    Widely expressed. In jejunal tissue, predominantly expressed in the apical region of the epithelial cell layer of the villi, weak expression, if any, in the crypt epithelium. Capillary endothelium and some cell types in the lamina propria also show expression.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane. Early endosome membrane. Cytoplasmic vesicle membrane. Cleavage furrow. In nonpolarized epithelial Caco-2 cells, found in the endoplasmic reticulum; in polarized cells, observed in vesicles in the apical cytoplasm. During mitosis, in mid-telophase, localized in the ingressing cleavage furrow. In late telophase, detected at the opposite poles of the daughter cells, in vesicles at the base of lamellipodia formed by the separating daughter cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0118 antibody
    • RAB 21 antibody
    • RAB21 antibody
    • RAB21, member RAS oncogene family antibody
    • RAB21_HUMAN antibody
    • Ras-related protein Rab-21 antibody
    see all

Images

  • Paraffin-embedded human colon tissue stained for RAB21 using ab224390 at 1/20 dilution in immunohistochemical analysis.

  • All lanes : Anti-RAB21 antibody (ab224390) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : RAB21 overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 24 kDa

References

ab224390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up