Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human RAB23 aa 1-237.
    Sequence:

    MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQ IQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAV SSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRT SVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGS HSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP


    Database link: Q9ULC3

  • Positive control

    • IHC-P: Human liver cancer and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Involvement in disease

    Defects in RAB23 are the cause of acrocephalopolysyndactyly type 2 (ACPS2) [MIM:201000]. A syndrome characterized by craniosynostosis, polysyndactyly, obesity, and cardiac defects.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781H0695 antibody
    • HSPC137 antibody
    • MGC8900 antibody
    • Rab 23 antibody
    • RAB family small GTP binding protein RAB 23 antibody
    • Rab23 antibody
    • RAB23, member RAS oncogene family antibody
    • RAB23_HUMAN antibody
    • Ras related protein Rab 23 antibody
    • Ras-related protein Rab-23 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for RAB23 using ab229977 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for RAB23 using ab229977 at 1/100 dilution in immunohistochemical analysis.

References

ab229977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up