Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab24
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Rab24 aa 50-100 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERA K


    Database link: Q969Q5

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in autophagy-related processes.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Post-translational
    modifications

    Isoprenylation is inefficient compared to other Rab family members.
  • Cellular localization

    Cytoplasm > cytosol. Membrane. Only about 20-25% is recovered in the particulate fraction.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTTHUMP00000161435 antibody
    • OTTHUMP00000161437 antibody
    • OTTHUMP00000223588 antibody
    • Rab 24 antibody
    • RAB24 antibody
    • RAB24, member RAS oncogene family antibody
    • RAB24_HUMAN antibody
    • Ras related protein Rab 24 antibody
    • Ras-related protein Rab-24 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Rab24 with ab214217 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up