Anti-RAB27A antibody (ab223044)
Key features and details
- Rabbit polyclonal to RAB27A
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RAB27A antibody
See all RAB27A primary antibodies -
Description
Rabbit polyclonal to RAB27A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Dog, Pig
-
Immunogen
Recombinant full length protein corresponding to Human RAB27A aa 2-221.
Sequence:SDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRV VYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDL TNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIAL AEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRS NGHASTDQLSEEKEKGACGC
Database link: P51159 -
Positive control
- IHC-P: Human spleen and pancreatic tissues. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab223044 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. -
Tissue specificity
Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells. -
Involvement in disease
Defects in RAB27A are a cause of Griscelli syndrome type 2 (GS2) [MIM:607624]. Griscelli syndrome is a rare autosomal recessive disorder that results in pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes. GS2 patients also develop an uncontrolled T-lymphocyte and macrophage activation syndrome, known as hemophagocytic syndrome, leading to death in the absence of bone marrow transplantation. Neurological impairment is present in some patients, likely as a result of hemophagocytic syndrome. -
Sequence similarities
Belongs to the small GTPase superfamily. Rab family. -
Cellular localization
Membrane. Melanosome. Late endosome. Lysosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Localizes to endosomal exocytic vesicles. - Information by UniProt
-
Database links
- Entrez Gene: 608699 Dog
- Entrez Gene: 5873 Human
- Entrez Gene: 11891 Mouse
- Entrez Gene: 606749 Pig
- Entrez Gene: 50645 Rat
- Omim: 603868 Human
- SwissProt: Q1HE58 Dog
- SwissProt: P51159 Human
see all -
Alternative names
- GS2 antibody
- GTP-binding protein Ram antibody
- HsT18676 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-RAB27A antibody (ab223044)
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for RAB27A (green) using ab223044 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab223044)Paraffin-embedded human spleen tissue stained for RAB27A using ab223044 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RAB27A antibody (ab223044)Paraffin-embedded human pancreatic tissue stained for RAB27A using ab223044 at 1/100 dilution in immunohistochemical analysis.
Protocols
References (1)
ab223044 has been referenced in 1 publication.
- Johnson IRD et al. A Paradigm in Immunochemistry, Revealed by Monoclonal Antibodies to Spatially Distinct Epitopes on Syntenin-1. Int J Mol Sci 20:N/A (2019). PubMed: 31795513
