Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB27B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human RAB27B aa 1-218.
    Sequence:

    MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKR VVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFD LTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARE LADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNG GNSGNLDGEKPPEKKCIC


    Database link: O00194

  • Positive control

    • IHC-P: Human prostate cancer and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human testis tissue stained for RAB27B with ab229874 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for RAB27B with ab229874 at a 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Zhang L  et al. Rab27b Is a Potential Indicator for Lymph Node Metastasis and Unfavorable Prognosis in Lung Adenocarcinoma. Dis Markers 2018:7293962 (2018). Read more (PubMed: 30627227) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up