Overview

  • Product name

    Anti-RAB31 antibody - C-terminal
    See all RAB31 primary antibodies
  • Description

    Rabbit polyclonal to RAB31 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human RAB31 aa 130-194 (C terminal).
    Sequence:

    LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGT IKVEKPTMQASRRCC


    Database link: Q13636

  • Positive control

    • WB: U-87 MG, NIH/3T3 and NBT-II cell lysates. IHC-P: Human adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 22 kDa.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human adrenal gland tissue stained for RAB31 using ab224421 at 1/20 dilution in immunohistochemical analysis.

  • Anti-RAB31 antibody - C-terminal (ab224421) at 1/100 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 22 kDa

  • All lanes : Anti-RAB31 antibody - C-terminal (ab224421) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 22 kDa

References

ab224421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up