Overview

  • Product name

    Anti-Rab3A antibody [6D1A12]
    See all Rab3A primary antibodies
  • Description

    Mouse monoclonal [6D1A12] to Rab3A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Rab3A aa 1-220. Expressed in E.coli.
    Sequence:

    MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPA FVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFIL MYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERG RQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTG AKQGPQLSDQQVPPHQDCAC


    Database link: P20336

  • Positive control

    • WB: Recombinant human Rab3A (aa 1-220) protein; Rab3A (aa 1-220)-hIgGFc-transfected HEK-293 cell lysate. Flow cyt: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    6D1A12
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500.
Flow Cyt 1/200 - 1/400.

Target

Images

  • Anti-Rab3A antibody [6D1A12] (ab234089) at 1/100 dilution + Recombinant human Rab3A (aa 1-220) protein


    Expected recombinant MW is 51 kDa.

  • All lanes : Anti-Rab3A antibody [6D1A12] (ab234089) at 1/100 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Rab3A (aa 1-220)-hIgGFc-transfected HEK-293 cell lysate cell lysate
  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Rab3A with ab234089 at 1/200 dilution (green) compared to a negative control (red).

References

ab234089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up