Overview

  • Product name

  • Description

    Rabbit polyclonal to RAB3B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Hamster, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human RAB3B aa 1-219.
    Sequence:

    MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPA FVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFIL MYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKG QLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGS SKNTRLSDTPPLLQQNCSC


    Database link: P20337

  • Positive control

    • WB: Mouse brain lysate; U-251 MG and U-87 MG whole cell lysates. IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 25 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-RAB3B antibody (ab235518) at 1/1000 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 3 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 25 kDa

  • Paraffin-embedded human colon cancer tissue stained for RAB3B using ab235518 at 1/100 dilution in immunohistochemical analysis.

References

ab235518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up