Overview

  • Product name

  • Description

    Rabbit polyclonal to Rab3D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Rab3D aa 184-219.
    Sequence:

    CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC


    Database link: O95716

  • Positive control

    • WB: RT-4 cell lysate. ICC/IF: MCF-7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 24 kDa.

Target

  • Function

    Protein transport. Probably involved in regulated exocytosis.
  • Tissue specificity

    Highly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated.
  • Sequence similarities

    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • D2-2 antibody
    • Glioblastoma overexpressed antibody
    • GOV antibody
    • RAB 16 antibody
    • RAB16 antibody
    • Rab3d antibody
    • Rab3D upregulated with myeloid differentiation antibody
    • RAB3D, member RAS oncogene family antibody
    • RAB3D_HUMAN antibody
    • RAD3D antibody
    • Ras-related protein Rab-3D antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized MCF-7 cells labeling Rab3D with ab221125 at 4 μg/mL (green).

  • Anti-Rab3D antibody (ab221125) at 1/100 dilution + RT-4 cell lysate

    Predicted band size: 24 kDa

References

ab221125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Mice Hepatocytes)
Permeabilization
Yes - 0.2% Triton X-100 in PBS
Specification
Mice Hepatocytes
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Formaldehyde

Dr. Armen Petrosyan

Verified customer

Submitted Apr 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up